Protein Info for Atu3022 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 122 to 151 (30 residues), see Phobius details amino acids 186 to 202 (17 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 299 (204 residues), 47.9 bits, see alignment E=6.7e-17

Best Hits

Swiss-Prot: 43% identical to YTEP_BACSU: Uncharacterized multiple-sugar transport system permease YteP (yteP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3022)

Predicted SEED Role

"Xylose ABC transporter, permease component" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEJ6 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Atu3022 sugar ABC transporter permease (Agrobacterium fabrum C58)
MKQDFQGRLHDLQEDVRRDWQLYLLLAPMLIWFAVFLYKPMYGLVIAFQDFSIFRGIEKS
PWVGFANFVELFRNDMFVRSFWNTITISGLGLIFAFPVPIILALMFNEVQNGTARSWAQT
VVYLPHFISVVIVAGIVINFLSPSIGIVNLMLKGLGFEPIYFLTQPEWFRPVYIGSSVWK
EAGFESIVYLAAIAGVSPTLYESARVDGASRWQMMWRITLPCILPTIVIMLIIRIGNLVE
VGFEYIILLYRPSTYETADVVSTFIYRTGLQGTQYDLATAAGLFNAVIAFVLVYSANRIS
RKVSSTSLW