Protein Info for Atu2835 in Agrobacterium fabrum C58

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF01208: URO-D" amino acids 3 to 339 (337 residues), 378.5 bits, see alignment E=1.5e-117 TIGR01464: uroporphyrinogen decarboxylase" amino acids 6 to 339 (334 residues), 411.1 bits, see alignment E=1.7e-127

Best Hits

Swiss-Prot: 100% identical to DCUP_AGRFC: Uroporphyrinogen decarboxylase (hemE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 100% identity to atu:Atu2835)

MetaCyc: 41% identical to uroporphyrinogen decarboxylase (Mus musculus)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]; 4.1.1.37 [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBL6 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Atu2835 uroporphyrinogen decarboxylase (Agrobacterium fabrum C58)
MSERKVMTVLNGKTVTPPPIWLMRQAGRYLPEYRETRKSAGSFLDLCYNPELASEVTLQP
IRRFGLDAAILFSDILVIPDALHRNVSFSEGKGPAMDPIDISGIEKLDASDVMAHLSPVF
ETVSRLRTSLPDETTLLGFCGAPWTVATYMIAGHGTPDQAPARLFGYQEPAAMEKLLALL
AEVSADYLVAQIDAGADAVQIFDSWAGVLGEKEFEEYAIKPVARIIASVRARRPSAKIIA
FAKGAGYLLRDYRRKTGANAIGLDWSVPLSFARDLQKEGPVQGNLDPMLMVAGGKALQDG
IDAVLQSLGQGPLIFNLGHGITPQADPENVTRLVQRVRSVGGAG