Protein Info for Atu2834 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03653: UPF0093
  • amino acids 24 to 164 (141 residues), 190.9 bits, E=7.4e-61
• TIGR00701: TIGR00701 family protein
  • amino acids 26 to 164 (139 residues), 162.3 bits, E=3.7e-52

Best Hits

Swiss-Prot: 43% identical to Y883_RICPR: UPF0093 membrane protein RP883 (RP883) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K08973, putative membrane protein (inferred from 100% identity to atu:Atu2834)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of alkaloids derived from shikimate pathway
• Limonene and pinene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

See Q7CW57 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Atu2834 hypothetical protein (Agrobacterium fabrum C58)
MRAGVALGVFAAFIALLFYADPADLYLWIKALHIIAVISWMAAIFYLPRLFIYHTDAPVG
SQQSETFKVMEQRLIRVIMNPAMMISWTLGLYLAWSVYGFSGGWLHAKIGLVLLLTATHV
YFSRSAKRFARDENTRPARHWRLMNEVPTVLMILIVILVVVKPFG