Protein Info for Atu2831 in Agrobacterium fabrum C58

Annotation: glucose inhibited division protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF07992: Pyr_redox_2" amino acids 5 to 154 (150 residues), 29 bits, see alignment E=2.2e-10 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 5 to 614 (610 residues), 793.8 bits, see alignment E=5e-243 PF01134: GIDA" amino acids 6 to 392 (387 residues), 551.8 bits, see alignment E=2.8e-169 PF00890: FAD_binding_2" amino acids 6 to 38 (33 residues), 22.6 bits, see alignment (E = 1.7e-08) PF12831: FAD_oxidored" amino acids 6 to 140 (135 residues), 34.7 bits, see alignment E=3.8e-12 PF21680: GIDA_C_1st" amino acids 458 to 548 (91 residues), 60.5 bits, see alignment E=6.8e-20 PF13932: SAM_GIDA_C" amino acids 555 to 609 (55 residues), 83.6 bits, see alignment 2e-27

Best Hits

Swiss-Prot: 100% identical to MNMG_AGRFC: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to atu:Atu2831)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBM0 at UniProt or InterPro

Protein Sequence (627 amino acids)

>Atu2831 glucose inhibited division protein A (Agrobacterium fabrum C58)
MHQSFDVVVIGGGHAGSEAAAAAARHGAKTALVTHKREAIGVMSCNPAIGGLGKGHLVRE
IDALDGLMGRVADAAGIQFRMLNRKKGPAVRGPRTQADRRLYREAMQREIDAMDNLTIIE
GDAFDIEMDNDRVAAVIMKNGSRIPCGAVVLTSGTFLRGLIHIGSEKIPAGRVGEMPSLG
LSDTLSRLGLAMGRLKTGTPARLDGRTIDWNAVDRQAADEDPVPFSFMTDHILNPQIECG
VTRTTPASHKIIQDNIHLSAMYSGQIEGVGPRYCPSIEDKITRFGERDGHQIFLEPEGLD
DYTIYPNGISTSLPAFVQEQFIRTIPGLEQVTILQPGYAIEYDYVDPRELKPSLECRKIP
GLFLAGQINGTTGYEEAGAQGLVAGLNASLYAGSADPLHFSRTESYIGVMIDDLTSKGVS
EPYRMFTSRAEYRLSLRVDNADLRLTPVAQKAGILGRERQQRFTDFLSDLDSVRALMKEL
SISPSQAAKQGLKLNQDGQRRSVYELLAYPDMTLQALAEHWPELNRLNAKVAEVLQIEAS
YAVYMQRQSADIVDIKRDEDRKIPDDFDFQSLSGLSNELKQKLEKARPENIAQAARVDGM
TPAAISLLLALLRKGTATRSEQLRMHQ