Protein Info for Atu2822 in Agrobacterium fabrum C58

Annotation: D-galactarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF08666: SAF" amino acids 15 to 83 (69 residues), 43.7 bits, see alignment E=4.8e-15 PF04295: GD_AH_second" amino acids 114 to 256 (143 residues), 149.9 bits, see alignment E=7e-48 PF20629: GD_AH_C" amino acids 266 to 508 (243 residues), 347.3 bits, see alignment E=6.3e-108

Best Hits

KEGG orthology group: K01708, galactarate dehydratase [EC: 4.2.1.42] (inferred from 100% identity to atu:Atu2822)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U525 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Atu2822 D-galactarate dehydratase (Agrobacterium fabrum C58)
MSENSEATILLNANDNVAVARRSIPAGGATGRGDLAALELIGRGHKVALKLIKSGDEVLK
YGQVIGIATQDIEAGRHVHLHNLAMVPSEHAHQFSVDIEEKGMVPEAERRTFMGYDRGLG
GVGTRNYIGVIASVNCSATVSRYIADYFNKQGGLDGFDNVDGVVALTHGGGCALNTKSEG
YRLLIRTIQGYARHPNFGGILLIGLGCETNQIAPILEHYKMEEGERLRTMTIQQHGGTRK
TIDAAITEIKAMLPMVNAARRTEQPLSKLKVALECGGSDGYSGISANPALGYASDLIVRN
GGTTVLSETPEIYGAEHLLTKRAVTPAVAEKLLQRIDWWRDYTARNGDELNNNPSHGNKL
GGLTTILEKSLGAVAKGGSMPLKAVYEFAETVTEQGFVFMDTPGYDPVAVTGQVAGGCNV
ICFTTGRGSVSGFKPSPCIKIATNSEMYEHMKEDMDINCGEIVTGTETIEESGKRIFEHI
LAVASGDKTVSEIYDYGDNEFVPWQVGAVT