Protein Info for Atu2821 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00392: GntR" amino acids 13 to 76 (64 residues), 78.2 bits, see alignment E=2.9e-26 PF07729: FCD" amino acids 96 to 221 (126 residues), 89.4 bits, see alignment E=2.6e-29

Best Hits

Swiss-Prot: 36% identical to UXUR_HAEIN: Uxu operon regulator (uxuR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 100% identity to atu:Atu2821)

Predicted SEED Role

"GntR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHB5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Atu2821 transcriptional regulator, GntR family (Agrobacterium fabrum C58)
MNGQAKIAEPRRLYQQIADQIRELIDVGEFLPGTRLPAERELAQKLGVSRPSLREALIAL
EIDNTVEIRMGSGVYVSTEALQTTHHTKSLGDSPSELMQARAALEGATIVLAANRMTDET
IAALRQILNTMQKEIEAGRKPLDQDRLFHVTIAEQSGNSVLARLVANLFDERHSPISAQL
RVKFEDRDTWTRALQEHEAILAALELKDPLLAQAAMHIHLEGSKRRWVDS