Protein Info for Atu2818 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (ribose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 276 to 304 (29 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 330 (279 residues), 165.4 bits, see alignment E=7.7e-53

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to atu:Atu2818)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW66 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Atu2818 ABC transporter, membrane spanning protein (ribose) (Agrobacterium fabrum C58)
MANIAEPKKGFAVSDRQKDIIQKFAALGSLFALVAVFSATSNAFFTVNNGMTIALQVTSI
ALLGIGATCVIITGGIDLSVGSVLALAGVVAALAVKELGMPVPIGMLLGILTGSLCGLIN
GLLVTRFKLPPFIATLGMMLIARGVALQITGARAVSGLGESFGELGNGALFRIVTIGDDG
FPNVVFPGIPYPVILMVVIALAVSFMLNRSILGRHIYAVGSNADAARLSGVNVARVTNFT
YILSGTLAGLTGCVLMSRLVTAQPNEGVMYELDAIASAVIGGTSLIGGVGTISGTAIGAF
VIGILRNGLNMNGVSAFTQQIIIGLVILVTVWIDQLRNRR