Protein Info for Atu2814 in Agrobacterium fabrum C58

Annotation: zinc-binding dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 162 to 180 (19 residues), see Phobius details PF08240: ADH_N" amino acids 23 to 130 (108 residues), 97.6 bits, see alignment E=7.4e-32 PF16912: Glu_dehyd_C" amino acids 149 to 319 (171 residues), 44.7 bits, see alignment E=1.7e-15 PF00107: ADH_zinc_N" amino acids 169 to 295 (127 residues), 72.8 bits, see alignment E=3.8e-24

Best Hits

KEGG orthology group: K00100, [EC: 1.1.1.-] (inferred from 100% identity to atu:Atu2814)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHB7 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu2814 zinc-binding dehydrogenase (Agrobacterium fabrum C58)
MLAIFCDTPGQLTAKDLPNPVRGEGEVLVRIRRIGVCGTDLHIFTGNQPYLSYPRIMGHE
LSGTVEEAPAGSHLSAGDVVTIIPYMSCGKCNACLKGKSNCCRNIGVLGVHRDGGMVEYL
SVPQQFVLKAEGLSLDQAAMTEFLAIGAHAVRRGAVEKGQKVLIVGAGPIGMAVAVFAVL
DGTEVTMIDGRTDRLDFCKDHLGVAHTVALGDGDKDRLSDITGGNFFDAVFDATGNPKAM
ERGFSFVGHGGSYVLVSIVASDISFNDPEFHKRETTLLGSRNATADDFERVLRALREGKV
PEALITHRMTLADVPSKFAGLTDPKAGVIKGMVEVA