Protein Info for Atu2811 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02746: MR_MLE_N" amino acids 9 to 110 (102 residues), 26.1 bits, see alignment E=8.9e-10 PF13378: MR_MLE_C" amino acids 176 to 391 (216 residues), 207.4 bits, see alignment E=2.3e-65

Best Hits

Swiss-Prot: 58% identical to LGD1_HYPJE: L-galactonate dehydratase (lgd1) from Hypocrea jecorina

KEGG orthology group: None (inferred from 100% identity to atu:Atu2811)

MetaCyc: 58% identical to L-galactonate dehydratase (Trichoderma reesei)
RXN-11380 [EC: 4.2.1.146]

Predicted SEED Role

"L-fuconate dehydratase (EC 4.2.1.68)" in subsystem L-fucose utilization temp (EC 4.2.1.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.146 or 4.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW73 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Atu2811 hypothetical protein (Agrobacterium fabrum C58)
MNPDPDYSAAYVILDTDEPRLKGHGLTFTIGRGNDICCMAIEAMRHLVVGTDLATVTENP
GKYWRHLTSDSQLRWIGPDKGAMHLATGAVVNAVWDLLAKKAGKPVWQLVADMSPEEIAD
IVDYRYLTDVLTRDDALAILRRAEAGKKERIETLKNEGYACYTTSAGWLGYDDAKLRRLC
QEAIDAGFNHVKMKVGRDLEDDIRRLTITREVIGPDRYLMIDANQVWEVDQAIEWVNKLA
FSKPFFIEEPTSPDDIAGHRKIRAAIGSVKVATGEMCQNRIMFKQFIAEGAIDVVQIDSC
RMGGLNEVLAVLLIAAKYNLPVWPHAGGVGLCEYVQHLSMIDYLVVSGTKEGRVIEYVDH
LHEHFIEPCDIRNAAYMPPKLPGFSIEMKPESIETYTFEE