Protein Info for Atu2803 in Agrobacterium fabrum C58

Annotation: Cobalamin biosynthesis associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 186 to 204 (19 residues), see Phobius details TIGR02435: precorrin-3B synthase" amino acids 13 to 387 (375 residues), 286.7 bits, see alignment E=1.4e-89 PF03460: NIR_SIR_ferr" amino acids 23 to 87 (65 residues), 37.6 bits, see alignment E=7.4e-14

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 100% identity to atu:Atu2803)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW81 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Atu2803 Cobalamin biosynthesis associated protein (Agrobacterium fabrum C58)
MAAVADPVQPFGRRGLCPALSAPMQTGDGFLSRVAFEADISPHVMVTLCGLAERHGNGLI
DITARGSLQFRGLTPESACALAKDVLALDLPLREGLAVETSPLAGRDDAEIADGRFLAEE
IRKGAGALALHDKLAAKTSVVIDGGGRLAMGDLLADIRLKAIRLEGRTFWQLLVGGPESK
ALKAGLVEPVAAAGVVLSLLVFLAEKGPFARGRDVDQQTVTAICGERLLGWGSGGEARTP
SLPLGLMMTGESRFAVGVAPAFGQIRSADLAHLCERADTFGIDALRPSLNHSLLFFGSSS
ACEALREAAVASGFVTTAGDARSSIAVCSGAPGCASAFLHTHDLAAFAAEECAALLDGSF
TLHVSGCGKGCAHPAPSLFTLAGTSDGLAFSISGRAGDPPAGILPFEQQQTALSRLARLY
EKEHKPGENAAIFFARLGREEIGAALRQDNQ