Protein Info for Atu2799 in Agrobacterium fabrum C58

Annotation: precorrin-6x reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00715: precorrin-6x reductase" amino acids 4 to 228 (225 residues), 135.5 bits, see alignment E=1.3e-43 PF02571: CbiJ" amino acids 5 to 245 (241 residues), 236 bits, see alignment E=2.2e-74

Best Hits

Swiss-Prot: 60% identical to COBK_SINSX: Precorrin-6A reductase (cobK) from Sinorhizobium sp.

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 100% identity to atu:Atu2799)

MetaCyc: 60% identical to precorrin-6A reductase (Pseudomonas denitrificans (nom. rej.))
Precorrin-6A reductase. [EC: 1.3.1.54]

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW85 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Atu2799 precorrin-6x reductase (Agrobacterium fabrum C58)
MTRSILILGGTADARILAGRLAEDSGYRILLSMAGRTLSPVEQPVPMRSGGFGGAAGLAD
FIRAEGFDILVDATHPYAARISANAVEAARLANIPLVVLSRPVWPRQPGDTWQSVHTVGQ
AVTALGTTGKRVFLALGRQELLPFEAAPQHSYLIRSVDPVEPPLRAPDARYITARGPFVT
EDEIRMLEENRIEVVISKNSGGSASYGKIEAARRLGLPVIMIERPQQLNDTPANNVTVPD
IATALTAIRHQLSLFENRGE