Protein Info for Atu2795 in Agrobacterium fabrum C58

Annotation: cobalamin biosynthetic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 166 to 184 (19 residues), see Phobius details PF01888: CbiD" amino acids 10 to 267 (258 residues), 311.7 bits, see alignment E=1.7e-97 TIGR00312: cobalamin biosynthesis protein CbiD" amino acids 17 to 318 (302 residues), 183 bits, see alignment E=3.6e-58

Best Hits

Swiss-Prot: 100% identical to CBID_AGRFC: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 100% identity to atu:Atu2795)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBQ6 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Atu2795 cobalamin biosynthetic protein (Agrobacterium fabrum C58)
MHMETDGKTLRRGWTTGTCAAAATKAACAALLTGEFPYPVDVELPSGARPAFSLATEEKG
ENFARAGVVKDAGDDPDVTHGALIESTVRRGEPGSGITFRAGKGVGIITRPGLPLPPGEP
AINPVPRRMIETAIREVAGENADFEVEISVRDGEKLAEKTLNGRLGILGGISILGTTGVV
IPFSCSAWIHSIWRGIDVARATGCTHVLGATGNTSEKAGQAVYDLPETALIDMGDFIGGM
LKYLRSHPVERVTIAGGVAKMTKLAQGMLDVHSKKGLADLEALAVLAAEAGGDDNLAVAI
RQANMVAHAFQLAESVGIDLGAVVAEKAWVTAAAALKTPAIALDILVFDRQGALKGRTTS
TPSHQPAPSSFGDRNRRT