Protein Info for Atu2793 in Agrobacterium fabrum C58

Annotation: cobyrinic acid a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 6 to 403 (398 residues), 329.5 bits, see alignment E=1.8e-102 PF01656: CbiA" amino acids 6 to 192 (187 residues), 55.8 bits, see alignment E=6.9e-19 PF07685: GATase_3" amino acids 248 to 435 (188 residues), 103.1 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 100% identical to COBB_AGRFC: Hydrogenobyrinate a,c-diamide synthase (cobB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to atu:Atu2793)

MetaCyc: 47% identical to CobB (Pseudomonas denitrificans (nom. rej.))
Hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolyzing). [EC: 6.3.5.9]

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBQ8 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Atu2793 cobyrinic acid a,c-diamide synthase (Agrobacterium fabrum C58)
MTARAIIIGAPRSGSGKTSVTIGLLRAFARRGVKVRGIKTGPDYIDPGFHAFATGTPGLN
LDSWAMQPDLLRHLFSQQTEDAELILIESAMGLFDGIPVAENRTGSAADLARLFRIPVLL
VLDVSGQSQTAATIAHGFAHYDPDVTMGAVVLNRAGSERHRTLCTEAIEKIGLPVVGCVL
RDPSLILPERHLGLVQASEHPEIDPHIDRLADAMEKSIDLDTLFSLAAPVDMPCGSVAAA
IAPPGQRIALAEDAAFTFLYPHLRRHWRAAGAEIVPFSPLADEAPDESCDICWLPGGYPE
LFAGKLADAVGFKAGITRFAETKPVHGECGGYMVLGERLEDAEGVIHAMTGLLSHATSFA
TRKMNLGYRQATIAADSPLGMAGDVLRGHEFHYARVIDPGRDQPFAHMADGQGRPLGPSG
GRRGFVSGTFFHAIAKGG