Protein Info for Atu2781 in Agrobacterium fabrum C58

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 324 (322 residues), 436.5 bits, see alignment E=2.9e-135 PF01018: GTP1_OBG" amino acids 5 to 158 (154 residues), 202.6 bits, see alignment E=4.2e-64 PF01926: MMR_HSR1" amino acids 162 to 278 (117 residues), 83.6 bits, see alignment E=1.7e-27 PF02421: FeoB_N" amino acids 163 to 320 (158 residues), 45.1 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 100% identical to OBG_AGRFC: GTPase Obg (obg) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03979, GTP-binding protein (inferred from 100% identity to atu:Atu2781)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CW97 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Atu2781 GTP-binding protein (Agrobacterium fabrum C58)
MKFLDEAKVYIKSGDGGAGAVSFRREKFIEFGGPDGGDGGRGGDVWVEVVNGLNTLIDFR
FQQHFKASIGQHGMGKTRTGAKGSDVVLKVPVGTQIFEEDNETLIMDLTKEGQRFRLAAG
GNGGFGNAYFKSSTNQAPTHANPGLAGEEKTIWLRLKLIADAGLVGLPNAGKSTFLATVT
RARPKIANYPFTTLHPNLGVATIDGREFVLADIPGLIEGAHEGVGIGDRFLGHVERTRVL
LHLVSAQEEKVGKAYKTVKAELDAYGGGLTDKPEIVALSQIDVLDEKELKKKAKELEKAC
GRPPLLLSAAAHIGMTEALRALRDIIVSASNGGDTALPDRSMPHESEVEEEDDRL