Protein Info for Atu2778 in Agrobacterium fabrum C58

Annotation: nicotinic acid mononucleotide adenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01467: CTP_transf_like
  • amino acids 12 to 191 (180 residues), 87.1 bits, E=6.2e-29
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 12 to 193 (182 residues), 152.5 bits, E=7.3e-49

Best Hits

Swiss-Prot: 100% identical to NADD_AGRFC: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to atu:Atu2778)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See Q8UBS2 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Atu2778 nicotinic acid mononucleotide adenyltransferase (Agrobacterium fabrum C58)
MPHVERGMVVGLFGGSFNPPHAGHALVAEIALRRLGLDQLWWMVTPGNPLKSRSELASLE
DRIAACERLVSDPRIKVTAFEKSLGISYTANTLAKVKAKNPHVRFIWIMGADNLKSFHRW
QKWREIAETFPIAVIDRPGSTLSYLSSTMAQAFSQARIDEDDAGVLWKKKAPAWVFIHGP
RSTLSSTALRNNHK