Protein Info for Atu2778 in Agrobacterium fabrum C58

Annotation: nicotinic acid mononucleotide adenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 12 to 193 (182 residues), 152.5 bits, see alignment E=7.3e-49 PF01467: CTP_transf_like" amino acids 12 to 191 (180 residues), 87.1 bits, see alignment E=6.2e-29

Best Hits

Swiss-Prot: 100% identical to NADD_AGRFC: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to atu:Atu2778)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBS2 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Atu2778 nicotinic acid mononucleotide adenyltransferase (Agrobacterium fabrum C58)
MPHVERGMVVGLFGGSFNPPHAGHALVAEIALRRLGLDQLWWMVTPGNPLKSRSELASLE
DRIAACERLVSDPRIKVTAFEKSLGISYTANTLAKVKAKNPHVRFIWIMGADNLKSFHRW
QKWREIAETFPIAVIDRPGSTLSYLSSTMAQAFSQARIDEDDAGVLWKKKAPAWVFIHGP
RSTLSSTALRNNHK