Protein Info for Atu2759 in Agrobacterium fabrum C58

Annotation: putative ftsK cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 891 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 226 to 242 (17 residues), see Phobius details PF13491: FtsK_4TM" amino acids 28 to 175 (148 residues), 64.4 bits, see alignment E=2.1e-21 PF17854: FtsK_alpha" amino acids 389 to 490 (102 residues), 96.9 bits, see alignment E=1.5e-31 PF01580: FtsK_SpoIIIE" amino acids 498 to 717 (220 residues), 249.9 bits, see alignment E=4.1e-78 PF09397: FtsK_gamma" amino acids 823 to 882 (60 residues), 89.1 bits, see alignment 2.5e-29

Best Hits

Swiss-Prot: 100% identical to FTSK_AGRFC: DNA translocase FtsK (ftsK) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to atu:Atu2759)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U526 at UniProt or InterPro

Protein Sequence (891 amino acids)

>Atu2759 putative ftsK cell division protein (Agrobacterium fabrum C58)
MGRMHSPTFDGRHTRFVLTAFFVRQIMALAGFALLATIALGIAALATWNVADPSLSYATG
NQPTNLLGYSGAIFADIVMQFLGLSAIIAFLPIIAWAIALIAGRKFNRIPARLVAWVAGA
IVCAASLGCFPAPVTWPLPNGIGGVIGDMILRFPALFIGAYPTGTIATILGVIFAAPAAW
LMLFAAGIVGGLDDELEREEAVPVATSKARAAREAEEDDEDDGEGFFANMLAFGAIAHYW
YITQARLRRLFGLKSKSLHTEFEHPYDFNEYEFGTLNEPSRLKTAINRLDQRSEPSFEER
AASRRQMSPPSIALDHDNNADDEPPFDADGRRLPNGILSDDESDDKFTPRQAPGRGQPRI
TAPSARPKPSERVAREAQASFIAADGFQLPTVHLLAEPKNVVRDNTLSEEVLEQNARLLE
GVLEDFGVKGEIIHVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARVAVVPG
RNAIGIELPNQTRETVFLRELVGSRDFENSKAKLAMALGKTIGGEPVIADLAKMPHLLVA
GTTGSGKSVAINTMILSLIYRMSPEQCRLIMIDPKMLELSIYDGIPHLLSPVVTDPKKAV
VALKWTVREMEERYKKMSKIGVRNIDGFNSRVQQALDKGEILTRTVQTGFDRQTGEAMYE
TEEFDLKPLPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVI
TGTIKANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDMLYMAGGGRIQRVHGPFVSDN
EVEEIVAYLKTQGSPEYLEAITEEEDEDGAGSGPAGAGNFSDSEDPYDQAVAVVLRDGKA
STSYVQRRLGIGYNRAASLIERMEQEGIIGPANHAGKREILVPTEADIIER