Protein Info for Atu2756 in Agrobacterium fabrum C58

Annotation: acyl-CoA thioesterase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR00189: acyl-CoA thioesterase II" amino acids 18 to 289 (272 residues), 325.1 bits, see alignment E=2e-101 PF13622: 4HBT_3" amino acids 35 to 115 (81 residues), 78.8 bits, see alignment E=4.6e-26 PF02551: Acyl_CoA_thio" amino acids 37 to 110 (74 residues), 29.3 bits, see alignment E=1e-10 amino acids 161 to 287 (127 residues), 131.2 bits, see alignment E=3.4e-42 PF20789: 4HBT_3C" amino acids 173 to 288 (116 residues), 86.7 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 48% identical to TESB_ECO57: Acyl-CoA thioesterase 2 (tesB) from Escherichia coli O157:H7

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 100% identity to atu:Atu2756)

MetaCyc: 48% identical to acyl-CoA thioesterase II (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWB7 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu2756 acyl-CoA thioesterase II (Agrobacterium fabrum C58)
MSHPSQTSDPMVNLIATLDLEKLEENLYRGESPQIGWQRVFGGQVIAQALIAAQRTVDDD
RFVHSLHAYFMRPGDPLVPIVYQVERIRDGASFCTRRVVAIQHGKAIFSMSASFQILEDG
FDHQIKMPDVTPPEKLMSEEQMQAAFLAKAPASIRKYWSNKRPIEIRPVSLTHYISKEKL
EPQQDIWVRAVGEVPADPRLQSAILAYLSDMTLLDTSLYAHGTTIFDPSIQVASLDHAMW
FHRPCRLDDWLLYTQDSPSASGARGLTRGNIFTRQGELVASVAQEGLIRKRAND