Protein Info for Atu2745 in Agrobacterium fabrum C58

Annotation: acetyl-coenzyme A synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02188: acetate--CoA ligase
  • amino acids 19 to 643 (625 residues), 1018.9 bits, E=0
• PF16177: ACAS_N
  • amino acids 23 to 79 (57 residues), 76.4 bits, 1.8e-25
• PF00501: AMP-binding
  • amino acids 81 to 466 (386 residues), 281 bits, E=2.1e-87
• PF13193: AMP-binding_C
  • amino acids 531 to 609 (79 residues), 94.7 bits, E=8.1e-31

Best Hits

Swiss-Prot: 100% identical to ACSA_AGRFC: Acetyl-coenzyme A synthetase (acsA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01895, acetyl-CoA synthetase [EC: 6.2.1.1] (inferred from 100% identity to atu:Atu2745)

MetaCyc: 56% identical to acetate--CoA ligase (Syntrophus aciditrophicus)
Acetate--CoA ligase. [EC: 6.2.1.1]

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• chitin deacetylation (3/4 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• superpathway of acetate utilization and formation (1/3 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (2/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

See Q8UBV5 at UniProt or InterPro

Protein Sequence (651 amino acids)

>Atu2745 acetyl-coenzyme A synthetase (Agrobacterium fabrum C58)
MSAKIYPVLKSAKARTLIDNERYQKWYQESVEDPEKFWDKHGRRIDWFKPYTKVKNTSFK
GRVPIKWFEDGLTNVSYNCIDRHLKTHGERTAIIWEGDNPYIDKKITYNQLYDYVCRLAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGVRGGKPIPLKENTDKAIDIAAKQYVIVNKVLVVRRTGGKTGWAPGRDIWYHQE
IATVKPDCPPVKMRAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTSMTHEYVFDYKDGEV
FWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
LRSLMGAGDQFVQRSSRESLRLLGTVGEPINPEAWEWYYHVVGEDKSPIVDTWWQTETGG
ILISPLPGATDLKPGSATRPFFGVQPQLVDAEGNVLEGPADGNLCIIDSWPGQSRSVYGD
HQRFVDTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
QVSEAAVVGYPHPIKGQGIYCYVTLMAGQSGDYALREELVKHVRNEIGPVATPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVEDLIANRQNRTAS