Protein Info for Atu2744 in Agrobacterium fabrum C58

Annotation: C4-dicarboxylate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03480: DctP" amino acids 36 to 313 (278 residues), 286.1 bits, see alignment E=1.6e-89 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 36 to 287 (252 residues), 245 bits, see alignment E=4.4e-77

Best Hits

Swiss-Prot: 35% identical to DCTP_VEREI: Solute-binding protein Veis_3954 (Veis_3954) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2744)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHF0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Atu2744 C4-dicarboxylate binding protein (Agrobacterium fabrum C58)
MRKLLLTTTAIAFAVGAAAPAMAEFNSRNIRVSNGINQDHPVGNGIKAMQACLDDKSGGK
LKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGLIPSLGVFDLPFLFANDKEADA
VMDGAFGDMMNKKLEEQGLVNLAYWENGFRNLSNSKHAVNKWEDFSGLKVRVMQNNIFLD
TFQNLGANATPMAFGEVFSALETNAIDAQENPYVTIDTSKFYEVQKYVTETNHAYTPFLF
LFSKPIFDSYTPEEQTALRECAVVGRDEERKVIRELNQKSLEKIKAAGLEVNTLSPEEQT
RIREKSMVVYEKHKAEIGADVVDAVLADLKKIRGQ