Protein Info for Atu2742 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details PF04290: DctQ" amino acids 23 to 151 (129 residues), 101.8 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 38% identical to Y1030_HAEIN: Putative TRAP transporter small permease protein HI_1030 (HI_1030) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2742)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWC9 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Atu2742 hypothetical protein (Agrobacterium fabrum C58)
MQKTINLFYRILEIILVLLLAGMSIMVFVNVVMRYTMNSGINVSEELSRYFFVWLTFLGA
VLTFRENSHMGIETLVMFLSRRARIVCMIVSNIIILGCSAIFFWGTWKQSAINASMHAPV
TKLSMIWVYGIGMFTGCLMFIIALERLYRYVTGGVTEDEIAQFAGENLTIEQLSER