Protein Info for Atu2734 in Agrobacterium fabrum C58

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 4 to 37 (34 residues), 22 bits, 1.7e-08
• PF00890: FAD_binding_2
  • amino acids 5 to 163 (159 residues), 25.2 bits, E=1.8e-09
• PF01266: DAO
  • amino acids 5 to 363 (359 residues), 212.6 bits, E=2.4e-66
• PF13450: NAD_binding_8
  • amino acids 8 to 46 (39 residues), 27 bits, 8.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2734)

Predicted SEED Role

"Aminobutyraldehyde dehydrogenase (EC 1.2.1.19)" (EC 1.2.1.19)

MetaCyc Pathways

• putrescine degradation V (2/2 steps found)
• putrescine degradation IV (2/3 steps found)
• L-lysine degradation X (4/6 steps found)
• putrescine degradation I (1/2 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)
• L-lysine degradation I (3/7 steps found)
• superpathway of L-lysine degradation (10/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.19

Sequence Analysis Tools

See A9CHF9 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Atu2734 dehydrogenase (Agrobacterium fabrum C58)
MTDIDAIIIGAGVIGLATARELSMHGLSVIILESETEFGSATSSRNSEVIHAGLYYPAGS
LKARLCVEGRQRLYDFCESHGVAHRHCGKLIVATSDDETPLLVALGAKGKANGCDDLELI
DQRHALSLEPALACSSALLSPSTGIIDSHGYMLALLGEAQDHGAALALNAPFERAEAIGD
GFRVHVGGKEPVSLTCRLLVNSAGLVAPMVAAMIEGLPSVAIPQARFAKGSYFSLTGKSP
FSRLIYPAPHTHGLGVHLTLDLAGQARFGPDVEWVDTIDYAVDPRRMEGFGDAIRRYWPG
LPEHTLAPAYSGIRPKISGPDEPAMDFRIDGPETHGFPGLVNLFGIESPGLTASLAIAGE
IAARLEA