Protein Info for Atu2714 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (thiamine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01276: thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein" amino acids 20 to 335 (316 residues), 403 bits, see alignment E=9.6e-125 TIGR01254: ABC transporter periplasmic binding protein, thiB subfamily" amino acids 26 to 330 (305 residues), 374.9 bits, see alignment E=3.1e-116 PF13416: SBP_bac_8" amino acids 48 to 275 (228 residues), 56.7 bits, see alignment E=7e-19 PF01547: SBP_bac_1" amino acids 49 to 277 (229 residues), 52.3 bits, see alignment E=1.8e-17 PF13531: SBP_bac_11" amino acids 68 to 274 (207 residues), 39.6 bits, see alignment E=1.1e-13 PF13343: SBP_bac_6" amino acids 82 to 295 (214 residues), 62.9 bits, see alignment E=6.8e-21

Best Hits

Swiss-Prot: 67% identical to THIB_BRUAB: Thiamine-binding periplasmic protein (thiB) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02064, thiamine transport system substrate-binding protein (inferred from 100% identity to atu:Atu2714)

MetaCyc: 58% identical to thiamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWF2 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Atu2714 ABC transporter, substrate binding protein (thiamine) (Agrobacterium fabrum C58)
MRRRLFLNSVIAASLFLPGLAAAQDKPELTVYTYESFVSEWGPGPKVKEAFEKVCVCTVN
FVGVADGVALLNRLKLEGSGSKADVVVGLDTNLVAEAKQTGLFDASGIDASAAKVPGGYK
DDVFVPYDYGHFAVIYDTQAVKNPPASLKELVEGDSAQKIAIQDPRTSTPGLGLLLWVKS
VYGDKAPEAWAKLRKRILTVTPGWSESYGLFTKGEVPMVLSYTTSPAYHMVAEKSDRYQA
AAFSEGHYIQIEVSGLLKNAPHKELAKQFLAFTLTSGFQDAIPENNWMMPVAATSAPLPE
AFSKLVVPQKTFLMDPEEVAKNRKAWIDEWLSAMSMN