Protein Info for Atu2708 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 379 (360 residues), 175.2 bits, see alignment E=9.6e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2708)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWF6 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu2708 MFS permease (Agrobacterium fabrum C58)
MVSEKALISKITWRLMPFLGLLYLIAYIDRQNVSYAKLQMVDALSLSEYAYGLGASLFFI
GYFLFEVPSNLFLNRFGASKWFARILVSWGAVTIALAYTQNATMFYILRFLLGLCEAGFF
PGVLFLMTLWFPRDYRGRMIGLFMIFSALANAVGAPLGGMLLDLDGFLGYAGWEWVFLAT
GIPAVIAGIVTFFYLDDTPDKAKFLTQDEKDWLKNRLAEENKGMEEHAEDGFKALVNPRV
LFMALCYVGFPLAAYGLSYWLPTIVKSFGVSNTTNGFINIIPWIIVAIALFVVPSAADKA
KNKTPYIVGPAFVGAFCLLMSALLSDPVLQFAFLCVAAAGIFAGQPVFWSLPGRFLKGAG
AAAGIAAINSVGNLGGFVAQNVVPWIKDQTGSTIAPMFFLAFCLALAGVLVIIATRKMGN
QVKAA