Protein Info for Atu2702 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF01925: TauE" amino acids 9 to 243 (235 residues), 141.4 bits, see alignment E=2e-45

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to atu:Atu2702)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWG0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Atu2702 hypothetical protein (Agrobacterium fabrum C58)
MSVFIVLMLFTTGFLSGVVNAIAGGGTFLTFGAMTLAGLPPIVANATSAIVQFPGYITSV
IAYGPEIRAHWREAVSLSVVSVVGGLAGSLLLLSLDNPAFRQLVPWLLLAATAVFAAGPW
LRPKASAERSPGNLPSLVFQGLASIYGGFFGAGMGIMMLAILGITSGGSYHHLNALKNLL
SVVIAVIAITIFVSGGVVSWWAALIMFPAAALGGYVGVHTARRVPQWIIRWLVIAVGLVL
TAYYFVSA