Protein Info for Atu2701 in Agrobacterium fabrum C58

Annotation: tRNA (guanine-N(1)-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 4 to 230 (227 residues), 262 bits, see alignment E=1.9e-82 PF01746: tRNA_m1G_MT" amino acids 25 to 221 (197 residues), 174.7 bits, see alignment E=9.4e-56

Best Hits

Swiss-Prot: 100% identical to TRMD_AGRFC: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 100% identity to atu:Atu2701)

MetaCyc: 48% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UBZ7 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Atu2701 tRNA (guanine-N(1)-)-methyltransferase (Agrobacterium fabrum C58)
MTFKATVLTLYPEMFPGHLQYSLAGKALERGQWSLDPIQIREFATDRHRSVDDTPAGGGA
GMVLKPDVLAAAIDHVSKGDTRPRLLMSPRGKPLSQNRVRELAAGDGAIIVCGRFEGVDQ
RVIEARGLEEVSIGDYILSGGEPAALTLLDAVVRILPGVMGNDLSGVHESFEGGLLEHPH
YTRPQLWEGRDIPAILTSGNHAAIDKWRHEQALALTKERRPDLLEKTQAETK