Protein Info for Atu2698 in Agrobacterium fabrum C58

Annotation: chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01795: chorismate mutase
  • amino acids 6 to 99 (94 residues), 158.1 bits, E=3.4e-51
• PF01817: CM_2
  • amino acids 13 to 91 (79 residues), 76.3 bits, E=8.6e-26

Best Hits

KEGG orthology group: K04092, chorismate mutase [EC: 5.4.99.5] (inferred from 100% identity to atu:Atu2698)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis III (2/4 steps found)
• L-phenylalanine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis II (1/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (1/5 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.5

Sequence Analysis Tools

See A9CHH1 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Atu2698 chorismate mutase (Agrobacterium fabrum C58)
MNNTEVKAQLSEYRQSIDNIDAALVHILAERFRCTKAVGVLKATYSLPPADPAREEYQIE
RLRRLAKDANLDPDFAEKFLNFVIKEVIRHHEAIAAEHGGHEKTA