Protein Info for Atu2693 in Agrobacterium fabrum C58

Annotation: cell division particle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF02881: SRP54_N" amino acids 193 to 253 (61 residues), 43 bits, see alignment E=8.6e-15 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 205 to 475 (271 residues), 317.7 bits, see alignment E=3e-99 PF13604: AAA_30" amino acids 276 to 374 (99 residues), 29.5 bits, see alignment E=1.3e-10 PF00448: SRP54" amino acids 276 to 475 (200 residues), 240.7 bits, see alignment E=2.2e-75 PF13401: AAA_22" amino acids 277 to 385 (109 residues), 30.4 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 100% identical to FTSY_AGRFC: Signal recognition particle receptor FtsY (ftsY) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to atu:Atu2693)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHH2 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Atu2693 cell division particle (Agrobacterium fabrum C58)
MALGFIKKVFSFGKDKAETEERPQEDAALERGNENASFEAALSDAEAHDAVDKDPVSELE
METAGGPAADEAVDVAPAEDDEEEDAPLLPGAELSGDMGLVPLSLLQAEAAAEEQGEPLP
EPLDAGLDADAMDALLNEAEAASAVESPAIPPVLPKGFSSAREREEPVPVAPQVKLTWFQ
RLRAGLARTSSQLTTQISALFTKRKLDEDTLDELEDLLIQSDLGVETAMRITGALSSERY
GKDVSGEDVARIMAGEITKVLKPVAKPLELDLSHKPHVILVVGVNGTGKTTTIGKLAAKL
SGSGLKVMLAAGDTFRAAAIEQLKIWADRTGSEFIGTKLGADAAGLAYDAYEQARAQKSD
VLIIDTAGRLQNKTELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNAMNQVEIFRNV
AGVSGLIMTKLDGTARGGILVAIAAKHKLPVYFIGVGEGVEDLEPFEAEDFAKAIAGV