Protein Info for Atu2692 in Agrobacterium fabrum C58

Annotation: intracellular septation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 21 to 207 (187 residues), 178.7 bits, see alignment E=6.4e-57 PF04279: IspA" amino acids 21 to 208 (188 residues), 201.8 bits, see alignment E=5.1e-64

Best Hits

Swiss-Prot: 100% identical to YCIB_AGRFC: Probable intracellular septation protein A (Atu2692) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06190, intracellular septation protein (inferred from 100% identity to atu:Atu2692)

Predicted SEED Role

"Probable intracellular septation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UC06 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Atu2692 intracellular septation protein (Agrobacterium fabrum C58)
MDIESNSKESEKMVAEISPLLKFVLELGPLMVFFFANSRGEWLASTFPVLTEFGGPIFIA
TGLFMIATATALTVSWILTRKLPIMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLF
GVILLGGLFFGQSLLGYVFNSAFKLTDEGWRKLTLRWGVFFLFLAVLNEVVWRMFTTDTW
VAFKVWGTMPITIIFTMAQMPFVMRHSVEPLGKDEK