Protein Info for Atu2688 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (heme)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 12 to 189 (178 residues), 139.4 bits, see alignment E=6.8e-45 TIGR01191: heme exporter protein CcmC" amino acids 52 to 233 (182 residues), 275 bits, see alignment E=1.6e-86

Best Hits

Swiss-Prot: 71% identical to CCMC_BRADU: Heme exporter protein C (cycZ) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to atu:Atu2688)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHH4 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Atu2688 ABC transporter, membrane spanning protein (heme) (Agrobacterium fabrum C58)
MNEQIFTITKFSDLANPTRFLALAARILPWLAGLTALVLAAGLYLSFTTDGDYQQGYTVR
IMYVHVPSAWLAMMCYSVMAVSAIGTLVWRHPLADVSHKAAAPIGAAFTLIALITGSLWG
KPMWGTWWVWDARLTSVFVLFLMYLGLIALNRAMDDPSRAARVSAVLILVGFVNIPIIKF
SVEWWNTLHQPASVIRMGGSAIDAEFLWPLLTMAIGFTLLFFTLHIAAMRNEIWRRRVAA
QRRLAARMANREG