Protein Info for Atu2687 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (heme)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 123 to 150 (28 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details PF03379: CcmB" amino acids 2 to 215 (214 residues), 237 bits, see alignment E=8.2e-75 TIGR01190: heme exporter protein CcmB" amino acids 4 to 215 (212 residues), 285 bits, see alignment E=1.8e-89

Best Hits

Swiss-Prot: 62% identical to CCMB_BRADU: Heme exporter protein B (cycW) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to atu:Atu2687)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHH5 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Atu2687 ABC transporter, membrane spanning protein (heme) (Agrobacterium fabrum C58)
MTVLFLRDIKLSIRAGGGALIGVLFFMTVVAVIPFGVGPDLNLLARIGPAIVWIGALLSA
LLGLDRLFQAERDDGSLDLILMQETPLVLTVFVKCLAHWVGTGLPLVLASPLLGLFMNMD
EVAIGAVMLTLLVGSPAITFIGAVGAAVAVALPRGGLLVSILVLPLAIPVLIFGVSASYA
AVQDPAPFMPPFFILCAITLFSAVTGPFFAALALRNVMD