Protein Info for Atu2681 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 315 to 343 (29 residues), see Phobius details amino acids 359 to 384 (26 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details amino acids 433 to 453 (21 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details amino acids 727 to 749 (23 residues), see Phobius details amino acids 779 to 802 (24 residues), see Phobius details amino acids 816 to 840 (25 residues), see Phobius details PF02687: FtsX" amino acids 273 to 387 (115 residues), 37.4 bits, see alignment E=1.2e-13 amino acids 731 to 842 (112 residues), 36 bits, see alignment E=3.3e-13

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to atu:Atu2681)

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHI0 at UniProt or InterPro

Protein Sequence (853 amino acids)

>Atu2681 hypothetical protein (Agrobacterium fabrum C58)
MIGSIFPSFTNIRNAARLARREIRGGLRGFYIFLACISLGTGAIAAVNSVSRAVTSAIAT
EGQSILAGDVRFELRNREATAEERSYLDGLGTVAVSTGLRSMARLADGSEQTLTEVKAID
GAYPLFGTFVADPNRPLGELLAGSGDTYGAVAAPLLLERLGIKVGDEILLGNAKLRLTGT
VVDEPDALSDGFGFAPRLVVSRDALFASGLIQTGSLVEHAYKIKLSDPAARATMTDAANK
AFPQAGWSIRTSDRAAPSLTENVNRFSQFLTLVGLTALIVGGVGVANAVRAFLDSKRTTI
ASLKCLGAPASVVTMTYLFQIAFIAAVGIVIGLVVGAVAPLVAMRFLEGVLPVPEGLAFY
PGALGLAALFGLLTTLAFAIVPLGQAREVPATALFREQGFEEGSWPSWPYLAATGLLLAA
LAALAIFSAEDRFIASVFLAAIAFAFVVLRLVASGVKAIAKRSPRVHSAALRLAIGNIHR
PGALTPSVVLSLGLGLTLLVTLTLIDGNLRRELTDSLPEKAPNFFFVDIQGSEVQGFRDL
VKREAPEGTLTEVPMLRGRIMALNGTDVTKMEVPPGGRWLLRGDRGITYSENRPENATLT
EGTWWEPDYSGEPLVSFAAKEAGNLGLKIGDKVTVNVLGRSITAKIANLRNVEWESLSIN
FVMVFSPNTFRGAPHAWLATLADPSATASDEGRILRAVTNTYPTITSVRVKDALDVVNRL
VGQLATAIRAAAAVALIASVLVLAGALAAGNRARTHDAVILKTLGGTRNLLIRAFSYEYM
MLGLATAVFALFAGGVSAWFVVARIMKLPSSFLPDVAIGTLVIALVMTVGIGLIGTWRIL
GQKAAPVLRQAGE