Protein Info for Atu2679 in Agrobacterium fabrum C58

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00657: Lipase_GDSL
  • amino acids 33 to 198 (166 residues), 63.2 bits, E=3.9e-21
• PF13472: Lipase_GDSL_2
  • amino acids 35 to 194 (160 residues), 89.5 bits, E=4e-29

Best Hits

KEGG orthology group: K01076, [EC: 3.1.2.-] (inferred from 100% identity to atu:Atu2679)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.1.2 or 3.1.2.-

Sequence Analysis Tools

See Q7CWH8 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Atu2679 esterase (Agrobacterium fabrum C58)
MRFKAALFHFIVILAGAFSVASAVAQERTLQLVGLGDSLMAGYQLPPTDSYTAQLEAALK
AKGINVAITNAGVSGDTSSGGLARAEWSVPDGTDGVILELGANDALRGIAPEQTEKNLDT
IISGFQKRNIAVLLVGIMAPPNMGDDYAKRFNPIFPRLAEKYNLPLYPFFLDGVVTDDAL
KLEDKMHPNTKGVAVMVEKSLPAVESFIKTIGAQKK