Protein Info for Atu2671 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 45 to 73 (29 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 256 (244 residues), 85.1 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 100% identity to atu:Atu2671)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHI2 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Atu2671 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MSQIAFWGAVELGLVFAFVAIGVYLAFRVLDFPDLTVDGSFPLGAAVAAVLIIAGLNAWV
ATAIAMVAGAAAGMVTATLNVRFKILNLLASILTMIALFSVNLRVMGKPNVALLNQDTMV
SPFYGLGLSEYLVRPLFVGVLVLIAVILVWRFLESDAGLAMRATGANARMARAQGVKTGN
QIYLGMALSNALVALGGALFAQTNGFADVTSGVGTIVVGLAAVIIGETLFGARGILIALI
GCVFGSIAYRLAIQLALSSDVLGLKASDLNFVTAVLVAIALILPRLRRGGATS