Protein Info for Atu2669 in Agrobacterium fabrum C58

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details PF01810: LysE" amino acids 19 to 209 (191 residues), 117.3 bits, see alignment E=3.1e-38

Best Hits

Swiss-Prot: 31% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2669)

Predicted SEED Role

"FIG097019: Amino acid efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHI4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Atu2669 RhtB family transporter (Agrobacterium fabrum C58)
MDFVPSLPTLIAFTIAILLLAVTPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTML
VAFGVAALIVASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALL
NGIWVNLLNPKVIIFFMTFLPQFVSATDPHVTGKLIFLGIWSIIVALPIGIGIVVTADIL
SAWLQRNRKVLRGLDYTIAGVFSLFAVKIFFTQTR