Protein Info for Atu2659 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details PF05977: MFS_3" amino acids 11 to 408 (398 residues), 127.6 bits, see alignment E=5.4e-41 PF07690: MFS_1" amino acids 23 to 323 (301 residues), 91.2 bits, see alignment E=6.6e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2659)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWJ2 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Atu2659 MFS permease (Agrobacterium fabrum C58)
MSSLPSAENRFGAFRHSSYRRFFSARFFSAFAIQIVSVSVGWQMYEVTGNAFYLGLIGLF
QFLPSLLLILVTGTVADRHNRRRIMAICLLMAALCAVALLGLTLTQSFSPWPVFAILVVF
GIERAFMGPAVQSLAPNLVPVEDLPNAIAWNSSSWQMASILGPVAGGLLYGLGASVAYSV
AFVLFIVSATLAVAIRKPEQRGPAKAISLETMLAGFKFISQEKIVLGAISLDLFAVLLGG
AVALMPIFAKEVLTLGPWGLGLLRAAPGIGAITVAVILAFKPIRHRAGLLMFVGVGLFGV
STVVFGLSQTAWLSIAALVVMGASDMVSVYVRETLIALWTPDEVRGRVNAVNMVFVGASN
ELGEFRAGTMAHVVGAVPAVVIGGAGTLAVAVIWALGFTKLRKIDNLDAPQ