Protein Info for Atu2656 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details PF07219: HemY_N" amino acids 26 to 131 (106 residues), 88 bits, see alignment E=4.3e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2656)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWJ5 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Atu2656 hypothetical protein (Agrobacterium fabrum C58)
MIRILTFAVIVLALGFGFSWLADRPGALSIVWQGQLIEMSLMVAASIIAALVAAVMLIWW
VVNAVWTSPNAARRYFRARKRDRGYQALSTGLIAAGAGNAILARKMTARTQGLLSADQEP
LIHLLDAQADLIEGKYDEARRKFEAMARDPETRELGLRGLYIEARRQGAYEAAQQYAEDA
AEKAPYLPWAAQATLENRCRNGQWDDAIRLLDQQKAASVIERGEAERLKAVLLTAKAGEK
LESDPVSAREDAKHALKLAKGLVPAALIAAKSYLREDNLRKAATVLEPVWKNEPHPQIAQ
LYVRARSGDTAIDRLKRAERLESLKPNNIESLFAVAQAALDAKEFAKARAKAEAAARIEP
RESIFLLMADIEEAETGDQGRVRYWMAQALRAPRDPAWVADGIVSEKWLPVSPVTGRLDA
FEWKAPFGQLEGPVEDLTIENAIAAAPARAEPAVKTIIVEAAPETRAEPKPAPATPIEVK
PIVSTAKENKPVPIEAPVGTDASDKKADAVPFFGGAPDDPGVKKSGAEAEPKTRLKLF