Protein Info for Atu2652 in Agrobacterium fabrum C58

Annotation: porphobilinogen deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01379: Porphobil_deam
  • amino acids 6 to 215 (210 residues), 255.7 bits, E=3.1e-80
• TIGR00212: hydroxymethylbilane synthase
  • amino acids 7 to 298 (292 residues), 346.1 bits, E=6.5e-108
• PF03900: Porphobil_deamC
  • amino acids 229 to 296 (68 residues), 61.7 bits, E=7.1e-21

Best Hits

Swiss-Prot: 100% identical to HEM3_AGRFC: Porphobilinogen deaminase (hemC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 100% identity to atu:Atu2652)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• tetrapyrrole biosynthesis II (from glycine) (4/4 steps found)
• superpathway of heme b biosynthesis from glutamate (8/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (5/6 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

See Q8UC46 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Atu2652 porphobilinogen deaminase (Agrobacterium fabrum C58)
MQTKPFRIGTRGSPLALAQAYETRSRLMAAHGLPEEMFEIVVLSTKGDRITDRALSEIGG
KGLFTEELENQLLSGELDIAVHSSKDMPTVLPEGLHLSAFLPREDMRDAFIGRTAPKLLE
LPQGAVVGSASLRRQALIRRLRPDLNVIVFRGLVDTRLRKLEEGQADATLLAFAGLKRLG
KDNVPTEILDPKEFPPAPAQGAIGVESRIGDARMDKLLAPINDRPTYDAVTCERAFLAAL
DGSCRTPIAGYATCEGDNLHFSGLILTPDGQTSHGVEISGNRRDALILGKKAGEEVRAKA
GSNFFEGWS