Protein Info for Atu2651 in Agrobacterium fabrum C58

Annotation: O-sialoglycoprotein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 7 to 329 (323 residues), 420.3 bits, see alignment E=4.4e-130 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 8 to 322 (315 residues), 327.8 bits, see alignment E=6.6e-102 PF00814: TsaD" amino acids 31 to 323 (293 residues), 318.6 bits, see alignment E=2.1e-99

Best Hits

Swiss-Prot: 100% identical to TSAD_AGRFC: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 100% identity to atu:Atu2651)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UC47 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Atu2651 O-sialoglycoprotein endopeptidase (Agrobacterium fabrum C58)
MPPFLRILGIETSCDETAASIVVRHADGRGEIVSDVVLSQLEEHSAYGGVVPEIAARAHV
EALDTLVEEALDQAGVKLADVDAIAATSGPGLIGGLLVGLMTGKAIAKAAGKPLYAINHL
EGHALTARLTDGLSFPYLMLLVSGGHTQLVLVRGVGEYERWGTTIDDALGEAFDKTAKLL
GLPYPGGPAVENAAAKGDPDRFPLPRPMVGEARLDFSFSGLKTAVRQAATAIAPLSEQDI
ADICASFQKAVSRTLKDRIGRGLARFKVEFPHINGEPALVVAGGVAANQEIRQTLQALCD
THGFRFVAPPHRLCTDNAAMIAWAGLERMAEGRQADALEVAPRSRWPLDGSAETLIGFGK
RGAKA