Protein Info for Atu2644 in Agrobacterium fabrum C58

Annotation: succinate dehydrogenase hydrophobic membrane anchor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details PF01127: Sdh_cyt" amino acids 1 to 110 (110 residues), 63.8 bits, see alignment E=8.4e-22 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 16 to 120 (105 residues), 104.8 bits, see alignment E=1.3e-34

Best Hits

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 100% identity to atu:Atu2644)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHJ7 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Atu2644 succinate dehydrogenase hydrophobic membrane anchor (Agrobacterium fabrum C58)
MDMRTPLGKVRGLGSAKEGTDHFLRQRVTAVANVPLLIFFVIFLIKYAGAPYPEVVAALS
NPLVAVIMALVLVSGLIHMKLGMQVIIEDYVHAEVSKLVLLMLNTFFAILIGGLSIFAIL
KIAFAG