Protein Info for Atu2637 in Agrobacterium fabrum C58

Annotation: succinyl-CoA synthetase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 3 to 298 (296 residues), 421.4 bits, see alignment E=9.5e-131 PF02629: CoA_binding" amino acids 6 to 105 (100 residues), 84.2 bits, see alignment E=1.4e-27 PF00549: Ligase_CoA" amino acids 157 to 280 (124 residues), 85.1 bits, see alignment E=7.2e-28

Best Hits

Swiss-Prot: 64% identical to SUCA_HUMAN: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (SUCLG1) from Homo sapiens

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 99% identity to agr:AGROH133_08853)

MetaCyc: 64% identical to succinyl-CoA ligase alpha subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; Succinate--CoA ligase (GDP-forming). [EC: 6.2.1.5, 6.2.1.4]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.4 or 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHK0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2637 succinyl-CoA synthetase alpha chain (Agrobacterium fabrum C58)
MSILVNKDTKILVQGLTGKTGTFHTEQALAYYGTQMVGGIHPKKGGETWTGSKGESLPIF
ATVAEAKEKTGADASVIYVPPAGAADAIIEAIEAEIPFITCITEGIPVMDMVRVKARLDR
SKSRLLGPNCPGIMTPEECKIGIMPGSIFRKGSVGIVSRSGTLTYEAVFQTSNEGLGQTT
AVGIGGDPVKGTEFIDILEMFLADDATQSIIMIGEIGGSAEEDAAQFLIDEAKKGRKKPM
AGFIAGRTAPKGRTMGHAGAVVSGGKGDAESKIAAMEAAGIKVSPSPARLGKTLVEVLKG