Protein Info for Atu2628 in Agrobacterium fabrum C58

Annotation: site-specific recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF02899: Phage_int_SAM_1" amino acids 22 to 107 (86 residues), 51.3 bits, see alignment E=1.2e-17 PF00589: Phage_integrase" amino acids 151 to 301 (151 residues), 111.2 bits, see alignment E=4.9e-36

Best Hits

Swiss-Prot: 100% identical to XERC_AGRFC: Tyrosine recombinase XerC (xerC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to atu:Atu2628)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UC70 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu2628 site-specific recombinase (Agrobacterium fabrum C58)
MEYRVTEILTFAEPDLLNERQSWLATLAGERRLADNTVEAYERDTRQFLRFLTGYIGRPA
AIRDIADLRPVDLRAFLANRRKEGAGARSLGRHLAGLRSLLHHLQKKGLVNAAGATAMRA
PKQPKSLPKPLTDRQALKITTAEAQLNEEPWIAARNAAVLSLLYGCGLRISEALGLTPAD
FPPGTRSLRITGKGNKTRIVPLLAVVTEAVDTYRKLCPYALAADEPMFLGARGGKLQPAI
IQREMQKLRGAFGLPENATPHALRHSFATHLLAGGGDLRTIQELLGHASLSTTQVYTGVD
TARLLEIYDNAHPRA