Protein Info for Atu2623 in Agrobacterium fabrum C58

Annotation: ATP synthase gamma chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR01146: ATP synthase F1, gamma subunit" amino acids 1 to 292 (292 residues), 332.8 bits, see alignment E=1.2e-103 PF00231: ATP-synt" amino acids 3 to 292 (290 residues), 334.9 bits, see alignment E=2.7e-104

Best Hits

Swiss-Prot: 100% identical to ATPG_AGRFC: ATP synthase gamma chain (atpG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02115, F-type H+-transporting ATPase subunit gamma [EC: 3.6.3.14] (inferred from 100% identity to atu:Atu2623)

Predicted SEED Role

"ATP synthase gamma chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UC75 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Atu2623 ATP synthase gamma chain (Agrobacterium fabrum C58)
MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMSAVLANIATAV
EADVAPALMTGTGKDDVHLLVVCTAERGLCGGFNSQIARFARDQARKLISEGKTVKIITV
GKKGYDSLRREFASLIIERIELRDVKKVGFENADQIAKKVISLFNAGEFDVCTLIYSEFK
SVISQIPTGLQLIPAATPVVEAAETTQTAVYEYEPDAASILEDLIPRNISVQVFRALLEN
VAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEAL