Protein Info for Atu2622 in Agrobacterium fabrum C58

Annotation: ATP synthase beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR01039: ATP synthase F1, beta subunit" amino acids 16 to 479 (464 residues), 835.8 bits, see alignment E=4.4e-256 PF02874: ATP-synt_ab_N" amino acids 19 to 85 (67 residues), 71.4 bits, see alignment E=1.1e-23 PF00006: ATP-synt_ab" amino acids 142 to 361 (220 residues), 234.9 bits, see alignment E=1.2e-73 PF22919: ATP-synt_VA_C" amino acids 368 to 446 (79 residues), 64.3 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 100% identical to ATPB_AGRFC: ATP synthase subunit beta (atpD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to atu:Atu2622)

MetaCyc: 80% identical to ATP synthase subunit beta, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UC76 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Atu2622 ATP synthase beta chain (Agrobacterium fabrum C58)
MAKAATPKKTAAVNGAGKVTQVIGAVVDVAFEGELPPILNALETQNNGNRLVLEVAQHLG
ENVVRTIAMDSTEGLVRGQSVADTGAPIEVPVGLETLGRIMNVIGEPVDEAGPIVTAKKR
AIHQDAPSYVEQSTEGQILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVA
KAHGGYSVFAGVGERTREGNDLYHEMIESNVNKLGGGEGSKAALVYGQMNEPPGARARVA
LTGLTIAENFRDEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGQMQE
RITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRSIAEKGIYPAVDPLDST
SRMLDPMIVGEEHYEVARKVQSTLQRYKSLQDIIAILGMDELSEEDKLTVARARKIERFL
SQPFFVAEVFTGSPGKLVALEDTIKGFKGLVNGEYDSLPEAAFYMVGSMEEAIEKAKKLT
AEAA