Protein Info for Atu2619 in Agrobacterium fabrum C58

Annotation: NAD-dependent formate dehydrogenase, C subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 29 to 270 (242 residues), 205 bits, E=5.7e-65
• PF02634: FdhD-NarQ
  • amino acids 32 to 269 (238 residues), 258.3 bits, E=4.1e-81

Best Hits

Swiss-Prot: 100% identical to FDHD_AGRFC: Sulfur carrier protein FdhD (fdhD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to atu:Atu2619)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See Q8UC79 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Atu2619 NAD-dependent formate dehydrogenase, C subunit protein (Agrobacterium fabrum C58)
MIVVSVEASYRRVARTALREGTPATGERAVPEEVPVAFSYGGSTHAVMMASPADLIDFAV
GFSLTEGIISMRSEIQAIEVVEAGQGYDVQVDLTDAEADALRARRRHMAGPVGCGLCGIE
SIEQAVRVVPDLSSVKSSVHGNDIVAAVKALNDAQTLNRETRAVHGAGFYNPREGLLAVR
EDVGRHNALDKLAGAVVNAGISAQMGIVAVTSRLSVEMVQKTAILGCPVLAAISAPTALA
IETADRAGITLVALVRGEDFEIFTRADRIIL