Protein Info for Atu2613 in Agrobacterium fabrum C58

Annotation: 5-aminolevulinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR01821: 5-aminolevulinic acid synthase" amino acids 1 to 344 (344 residues), 606 bits, see alignment E=1.5e-186 PF00155: Aminotran_1_2" amino acids 3 to 333 (331 residues), 260.7 bits, see alignment E=1.2e-81

Best Hits

Swiss-Prot: 99% identical to HEM1_RHIRD: 5-aminolevulinate synthase (hemA) from Rhizobium radiobacter

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 100% identity to atu:Atu2613)

MetaCyc: 64% identical to 5-aminolevulinate synthase 2 (Cereibacter sphaeroides)
5-aminolevulinate synthase. [EC: 2.3.1.37]

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWM7 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Atu2613 5-aminolevulinate synthase (Agrobacterium fabrum C58)
MGQNPKVIEAMKAAIDHCGAGAGGTRNISGTNHYHVLLEQELADLHGKESALIFTSGYVS
NWATLGTLGQKIPGLIIFSDALNHASMIEGIRYGRCERVIWKHNDLEDLEAKLKAADPNA
PKLIAFESVYSMDGDIAPIREICDLADRYGAMTYLDEVHAVGMYGPRGGGIAEREGLMDR
LTIIEGTLGKAFGVMGGYITGSTAVCDFIRSFASGFIFTTALPPSLAAGAIASIQHLKAS
PFERARHQDRVRKLRGLLDARGIPHMDNPSHIVPVMVGDAAKCKWISDILLDNHGVYVQP
INYPTVPRKTERLRITPTPLHTDADIEQLVGALHQLWSHCALARAVA