Protein Info for Atu2612 in Agrobacterium fabrum C58

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 10 to 390 (381 residues), 428.8 bits, E=9.1e-133
• PF02670: DXP_reductoisom
  • amino acids 11 to 138 (128 residues), 132.5 bits, E=2.3e-42
• PF08436: DXP_redisom_C
  • amino acids 152 to 235 (84 residues), 126.6 bits, E=4.9e-41
• PF13288: DXPR_C
  • amino acids 267 to 384 (118 residues), 132.4 bits, E=1.5e-42

Best Hits

Swiss-Prot: 100% identical to DXR_AGRFC: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to atu:Atu2612)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (9/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See Q8UC86 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Atu2612 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Agrobacterium fabrum C58)
MTNASEMPRKLTILGSTGSIGTNTLDVVRQLGGRDGFEIMALTGAGNIALLAEQAREFGA
QLAVTADDDKYEALKSALAGTGIKVAAGMAGLEEAASMDAGWVMAAIAGTPGLAPTLTAA
RRGADIALANKECLVSAGDVFLRTVKQGGGRLIPVDSEHSAIFQCLTGEYKQAVERIVLT
ASGGPFRTWSRDEMSNVTADIARAHPNWSMGLKVSIGSASMFNKGLEMIEAKYLFDLRPD
QVDVIVHPQSIIHSMVGYTDGSYIAQLGSPDMRTAISYALTYPERGNLSVERLDFAKLAR
LDFEAPDEARFPALRLARMALERGGLQGAALNAAEETAFHAFVAGGIGFLDMAEIVETVM
DRMHDGRTAETMDDVFSADEEARRHALELIATKEKAA