Protein Info for Atu2609 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, ROK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 3 to 296 (294 residues), 170.2 bits, E=3.8e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2609)

Predicted SEED Role

"N-acetylmannosamine kinase (EC 2.7.1.60)" in subsystem Sialic Acid Metabolism (EC 2.7.1.60)

MetaCyc Pathways

• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (3/6 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation I (1/4 steps found)
• CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (1/5 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• superpathway of CMP-sialic acids biosynthesis (1/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.60

Sequence Analysis Tools

See A9CHK8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Atu2609 transcriptional regulator, ROK family (Agrobacterium fabrum C58)
MIVCFDIGGTTIKGAIAHTPDDIRPVPRIPTPKTSFEDFAAGLKSVIDASGGTPGCVSLS
IAGVIDPDTGKATVANIPSIHGRVLKDELEKALNLPVIVSNDADCFVIAESEIGSGQGHR
VVFGVILGTGVGGGLVIDGKLINSHGGFAGEWGHGPVAATSAGNPPVSLPRFECGCGLTG
CVDAIGSARGMEKLHAHLHRQEMTSEDIIAAWQAGDAKAARTIDVLIDILASPLAMVINV
TGATIVPVGGGLSNSRELLAALDEAVRGRILRRFNRPLVVPAICRIEPGLIGSAVIGLKY
AQEIARPS