Protein Info for Atu2606 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00392: GntR" amino acids 18 to 81 (64 residues), 68 bits, see alignment E=4.4e-23 PF07702: UTRA" amino acids 105 to 240 (136 residues), 122.5 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K03710, GntR family transcriptional regulator (inferred from 100% identity to atu:Atu2606)

Predicted SEED Role

"Predicted transcriptional regulator of N-Acetylglucosamine utilization, GntR family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHL1 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Atu2606 transcriptional regulator, GntR family (Agrobacterium fabrum C58)
MNGAALNLEDLQSGGGPLYLKLRQTIEDAINGGRLKHGDALPPERDIAESACVSRVTVRK
AVDDLVRDGLLVRRHGSGTFVVKPITRMQQPLTKLTSFTEDMRRRGMTASTQWLDRGLFH
PTGDEMMTLGLSQSAMVARLTRLRLANDQPIALEVTSLPGDILPDPQLVENSLYLELEKS
GIRPVRAIQRISARNLTDEETLLLGVPPGSAALSVQRMAYLESGRLMEISLALYRSDAYD
LVAELTMGPE