Protein Info for Atu2594 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 222 to 238 (17 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 361 (344 residues), 62.2 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2594)

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHL9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Atu2594 MFS permease (Agrobacterium fabrum C58)
MPSALSIVINNPSIRIGALAILFFGFSNAATAPYQAVIGIREIGLSNSVYSLLMLFAAVI
NVSASVLMGIVADRLGEYRKPMLLIALFGVSGYMLVYLVGNATAFVSAKLILLPIFGAMN
SLIFAHVRADARNLSTGDMIAVNSIMRATISLSWVLVPGIVGIFLVNSGNMLLAFLFSGV
CALICFLLVAFCLPRAATPAVVNNEARFGLMASLAEIGSRRVLLRIIAIALICSMLHLND
SIRSLIITGQAKGTVADIGIVAGIVAALEIVFILLWGWIEKKVPQTLTLAAGAVLYAIYL
ILQGLASAPWHIYAQTVISALGAAAIISIPITYLQELIADRPGLGSSLIAVNIFLGAGLG
ALIFAVGTLVSSYSGTSILGAIVGLGGVYMLYTLDGTGRRR