Protein Info for Atu2582 in Agrobacterium fabrum C58

Annotation: UDP-glucose/GDP-mannose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 1 to 172 (172 residues), 150 bits, see alignment E=1.2e-47 PF03446: NAD_binding_2" amino acids 1 to 128 (128 residues), 29.4 bits, see alignment E=1.5e-10 TIGR03026: nucleotide sugar dehydrogenase" amino acids 2 to 409 (408 residues), 417.9 bits, see alignment E=2e-129 PF00984: UDPG_MGDP_dh" amino acids 195 to 285 (91 residues), 109.3 bits, see alignment E=1.7e-35 PF03720: UDPG_MGDP_dh_C" amino acids 313 to 412 (100 residues), 72.6 bits, see alignment E=6.2e-24

Best Hits

Swiss-Prot: 53% identical to UGND_PSEAE: UDP-N-acetyl-D-glucosamine 6-dehydrogenase (wbpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13015, UDP-N-acetyl-D-glucosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to atu:Atu2582)

MetaCyc: 53% identical to UDP-N-acetyl-D-glucosamine 6-dehydrogenase monomer (Pseudomonas aeruginosa PAO1)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CWQ5 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Atu2582 UDP-glucose/GDP-mannose dehydrogenase (Agrobacterium fabrum C58)
MIGLGYVGLPLAMTVAKAGFKVVGFDIDPGKITAIEAGRSYIEAVSDEVLASVRQDDGFV
ATSDFLRLAECDVIAICVPTPLTKYREPDLSYVEKTCRDIAAHLRKGQLVVLESTTYPGT
TDGVVKTILESTGLVSGVDFFIGFSPEREDPGNRDFETSTIPKVVAGDGEAAGKLMAAFY
GSVVKKIVPVSTNATAEAVKITENVFRAVNIALVNELKVVYEAMGIDIWEVIDAAKTKPF
GFMPFYPGPGLGGHCIPIDPFYLTWKSREYELPTRFIELAGEINTGMPRHVVGRVAEALD
IHSGKALSRSKVLVVGLAYKKNVPDIRESPSLKLLELIQERGGDAAYFDPYVAEIPKTRE
YSHLMGMKSISWDRETIGSFDAVLVATDHDNVDYAALSDWAPLIIDTRNVFARRDIAAKH
IIKA